missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Asparagine synthetase Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP2-56407PEP
207.20 EUR valid until 2025-03-28
Use promo code "25306" to get your promotional price.
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparagine synthetase. Source: E.coli Amino Acid Sequence: MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ The Asparagine synthetase Recombinant Protein Antigen is derived from E. coli. The Asparagine synthetase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
440 | |
Asparagine synthetase Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4. | |
asparagine synthetase, asparagine synthetase (glutamine-hydrolyzing), asparagine synthetase [glutamine-hydrolyzing], Cell cycle control protein TS11, EC 6.3.5.4, Glutamine-dependent asparagine synthetase, TS11, TS11 cell cycle control protein | |
Unlabeled | |
100 μL | |
E.Coli |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
ASNS | |
Recombinant Protein Antigen | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50646. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Novus Biologicals™ Asparagine synthetase Recombinant Protein Antigen > Quantity: 100μL
For Research Use Only.
Spot an opportunity for improvement?Share a Content Correction