missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Asparagine synthetase Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand:  Novus Biologicals™ NBP2-56407PEP

207.20 EUR valid until 2025-03-28
Use promo code "25306" to get your promotional price.


Product Code. 18235434

  • 259.00 € / 100µL

Please to purchase this item. Need a web account? Register with us today!

Explore more special offers
This item is not returnable. View return policy

Description

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Asparagine synthetase. Source: E.coli Amino Acid Sequence: MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYLWLCYNGEIYNHKKMQ The Asparagine synthetase Recombinant Protein Antigen is derived from E. coli. The Asparagine synthetase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

440
Asparagine synthetase Recombinant Protein Antigen
PBS and 1M Urea, pH 7.4.
asparagine synthetase, asparagine synthetase (glutamine-hydrolyzing), asparagine synthetase [glutamine-hydrolyzing], Cell cycle control protein TS11, EC 6.3.5.4, Glutamine-dependent asparagine synthetase, TS11, TS11 cell cycle control protein
Unlabeled
100 μL
E.Coli
>80% by SDS-PAGE and Coomassie blue staining
Store at −20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
ASNS
Recombinant Protein Antigen
RUO
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50646. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

One moment while we fetch your results.
Certificates
Special Offers

Special Offers

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Novus Biologicals™ Asparagine synthetase Recombinant Protein Antigen > Quantity: 100μL

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

For Research Use Only.