missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein

Recombinant Protein

Brand:  Invitrogen™ RP104388

176.67 EUR valid until 2025-03-29
Use promo code "24111" to get your promotional price.


Product Code. 30209820

  • 265.00 € / 100µL

Please to purchase this item. Need a web account? Register with us today!

Explore more special offers

Alert:

To receive the discount customers must purchase three of the same product at list price in a single order to receive 33% discount. There is no limit to the multiples of 3 that customers can buy. Use promo code ”24111” to get your promotional price

This item is not returnable. View return policy

Description

Description

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
TRUSTED_SUSTAINABILITY
Specifications

Specifications

P0DUB6
Blocking Assay, Control
276
100 μL
1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1 A (salivary); amylase, salivary, alpha-1 A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1 A; salivary and hepatic alpha-amylase
AMY1A
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human alpha Amylase 1 (aa 242-300) Control Fragment
RUO
alpha Amylase 1
Unconjugated
Recombinant
KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

One moment while we fetch your results.
Certificates
Special Offers

Special Offers

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein > 100 μL; Unlabeled

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.