missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CTPS (aa 539-591) Control Fragment Recombinant Protein

Product Code. 30199355
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30199355

Brand: Invitrogen™ RP104921

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65655 (PA5-65655. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

There are two genes encoding members of a new family of type II integral membrane proteins. Both are ubiquitously expressed, and tissue-specific alternative mRNA initiation and splicing generate at least two major isoforms of each protein, with the smaller isoforms being truncated at the N-terminus. These proteins are called nesprin-l and -2 for nuclear _envelope _spectrin repeat, as they are characterized by the presence of multiple, clustered spectrin repeats, bipartite nuclear localization sequences and a conserved C-terminal, single transmembrane domain. Transient transfection of EGFP-fusion expression constructs demonstrated their localization to the nuclear membrane with a novel C-terminal, TM-domain-containing sequence essential for perinuclear localization. Nesprin-l is developmentally regulated in both smooth and skeletal muscle and is relocalized from the nuclear envelope to the nucleus and cytoplasm during C2Cl2 myoblast differentiation. Nesprins may function as 'dystrophins of the nucleus' to maintain nuclear organization and structura integrity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P17812
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1503
Name Human CTPS (aa 539-591) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cb1040; CTP synthase; CTP synthase 1; CTP synthase 1 A; CTP synthase a; CTP synthetase 1; CTPS; ctps1; ctps1a; ctpsa; cytidine 5-prime triphosphate synthetase; cytidine 5'-triphosphate synthase; cytidine 5'-triphosphate synthetase; IMD24; UTP--ammonia ligase 1; wu:fb49e03; wu:fe17b03
Common Name CTPS
Gene Symbol CTPS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.