missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human Glutamine Synthetase (aa 227-365) Control Fragment Recombinant Protein

Product Code. 30212017
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212017

Brand: Invitrogen™ RP88686

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82305 (PA5-82305. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glutamine synthase is part of the glutamine synthetase family. Ammonia incorporation in animals occurs through the actions of glutamate dehydrogenase and glutamine synthase. Glutamate plays the central role in mammalian nitrogen flow, serving as both a nitrogen donor and nitrogen acceptor. It also has an important role in controlling metabolic regulations of neurotransmitter glutamate. Because of the multiple functions and importance of GS in cellular metabolism, both catalytic activities and synthesis are highly regulated. The activity of GS is controlled by adenylylation. Its activity is decreased in the cerebral cortex of brains affected by Alzheimer's disease, particularly in the vicinity of senile plaques. It is also decreased under conditions of glucose deprivation.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P15104
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2752
Name Human Glutamine Synthetase (aa 227-365) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias cell proliferation-inducing protein 59; GLNA; GLNS; Glul; GLUL protein; Glutamate ammonia ligase; glutamate decarboxylase; glutamate-ammonia ligase; glutamate--ammonia ligase; glutamate-ammonia ligase (glutamine synthase); glutamate-ammonia ligase (glutamine synthetase); glutamine synthase; glutamine synthetase; Glutamine synthetase (glutamate-ammonia ligase); glutamine synthetase 1; glutamine synthetase I; GS; Palmitoyltransferase GLUL; PIG43; PIG59; Proliferation inducing protein 43; proliferation-inducing protein 43
Common Name Glutamine Synthetase
Gene Symbol GLUL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.