missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human PCID1 (aa 36-178) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP101061
This item is not returnable.
View return policy
Description
This gene encodes a protein that is part of the eurkaryotic translation initiation factor 3 complete (eIF-3) required for protein synthesis. Elevated levels of the encoded protein are present in cancer cell lines. Inactivation of the encoded protein has been shown to interfere with translation of herpes virus mRNAs by preventing the association of mRNAs with the ribosomes. A pseudogene of this gene is located on the X chromosome.
Specifications
| Q7L2H7 | |
| Blocking Assay, Control | |
| 10480 | |
| 100 μL | |
| RUO | |
| EIF3M | |
| Human | |
| GGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKS | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| PCID1 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| B5; B5 receptor; dendritic cell protein; dendritic cell protein GA17; eIF3m; Eukaryotic translation initiation factor 3 subunit M; eukaryotic translation initiation factor 3, subunit M; fetal lung protein B5; FLJ29030; GA17; HFLB5; hFL-B5; PCI domain containing 1 (herpesvirus entry mediator); PCI domain-containing protein 1; PCID1; PNAS-125; RGD1565840; Tango7; transport and golgi organization 7 homolog | |
| Unconjugated | |
| Recombinant | |
| E. coli |