missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human TMEM110 (aa 213-252) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP101617
This item is not returnable.
View return policy
Description
Acts as a regulator of store-operated Ca(2+) entry (SOCE) at junctional sites that connect the endoplasmic reticulum (ER) and plasma membrane (PM), called ER-plasma membrane (ER-PM) junction or cortical ER (PubMed:26322679, PubMed:26644574). SOCE is a Ca(2+) influx following depletion of intracellular Ca(2+) stores (PubMed:26322679). Acts by interacting with STIM1, promoting STIM1 conformational switch (PubMed:26322679). Involved in STIM1 relocalization to ER-PM junctions (PubMed:26644574). Contributes to the maintenance and reorganization of store-dependent ER-PM junctions (PubMed:26644574). [UniProt]
Specifications
| Q86TL2 | |
| Blocking Assay, Control | |
| 375346 | |
| 100 μL | |
| RUO | |
| STIMATE | |
| Human | |
| VDNFLMRKGKTKAKLEERGANQDSRNGSKVRYRRAASHEE | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| TMEM110 | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 1810038N08Rik; 2310014H19Rik; AW554125; STIM-activating enhancer; STIM-activating enhancer encoded by TMEM110; STIMATE; Store-operated calcium entry regulator STIMATE; Tmem110; Transmembrane protein 110 | |
| Unconjugated | |
| Recombinant | |
| E. coli |