missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Inorganic Pyrophosphatase/PPA1 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP1-87788PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPA1. The Inorganic Pyrophosphatase/PPA1 Recombinant Protein Antigen is derived from E. coli. The Inorganic Pyrophosphatase/PPA1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-87788. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
| 5464 | |
| Chromatography | |
| 0.5mg/mL | |
| PBS and 1M Urea, pH 7.4. | |
| PPA1 | |
| 24kDa | |
| 0.1mL | |
| metabolism, Signal Transduction | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87788. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
| Human | |
| >80% | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| Unlabeled | |
| Inorganic Pyrophosphatase/PPA1 | |
| RUO | |
| E.Coli | |
| GFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAK |
For Research Use Only