Learn More
Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP1-87456PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSRA. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-87456. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications
4482 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
Methionine Sulfoxide Reductase A | |
RUO |
Human | |
PBS and 1M Urea, pH 7.4. | |
MSRA | |
25kDa | |
0.1 mL | |
ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG |
Product Suggestions
Customers who viewed this item also viewed.
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
For Research Use Only