missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Brand: Novus Biologicals™ NBP1-87456PEP

Product Code. 18725663

259.00 € / 0.10mL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MSRA. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen is derived from E. coli. The Methionine Sulfoxide Reductase A Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-87456. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

Specifications

Gene ID (Entrez)	4482
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
For Use With (Application)	Blocking/Neutralizing, Control
Label Type	Unlabeled
Product Type	Methionine Sulfoxide Reductase A
Regulatory Status	RUO

Species	Human
Formulation	PBS and 1M Urea, pH 7.4.
Gene Symbol	MSRA
Molecular Weight (g/mol)	25kDa
Quantity	0.1mL
Immunogen	ASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVG

Product Suggestions

For Research Use Only

Novus Biologicals™ Methionine Sulfoxide Reductase A Recombinant Protein Antigen

Description

Specifications

Product Suggestions

Documents

Special Offers