missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human MMS22L (aa 730-820) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP107538
This item is not returnable.
View return policy
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66891 (PA5-66891. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Component of the MMS22L-TONSL complex, a complex that stimulates the recombination-dependent repair of stalled or collapsed replication forks. The MMS22L-TONSL complex is required to maintain genome integrity during DNA replication by promoting homologous recombination-mediated repair of replication fork-associated double-strand breaks. It may act by mediating the assembly of RAD51 filaments on ssDNA.
Specifications
| Q6ZRQ5 | |
| Blocking Assay, Control | |
| 253714 | |
| 100 μL | |
| C6orf167; dJ39B17.2; Methyl methanesulfonate-sensitivity protein 22-like; MMS22 like, DNA repair protein; MMS22L; MMS22-like, DNA repair protein; Protein MMS22-like | |
| MMS22L | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human MMS22L (aa 730-820) Control Fragment | |
| RUO | |
| MMS22L | |
| Unconjugated | |
| Recombinant | |
| MSQVVPFSQLADAAADFTLLAMDMPSTAPSDFQPQPVISIIQLFGWDDIICPQVVARYLSHVLQNSTLCEALSHSGYVSFQALTVRSWIRC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Invitrogen™ Human MMS22L (aa 730-820) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Spot an opportunity for improvement?Share a Content Correction
